(data stored in SCRATCH zone)

EMBL: CP000271.PE205

CP000271.PE205       Location/Qualifiers
FT   CDS             241638..242084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2822"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2822"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33173"
FT                   /db_xref="GOA:Q13RW6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW6"
FT                   /protein_id="ABE33173.1"
FT                   /translation="MSLKDRINDDMKAAMRARETERLGTVRLLLAAIKQREVDERITLD
FT                   DTAITAVIDKMIKQRKDSISQFEAAGRTDLADKEKAELAILSAYMPEQMSEAEIVAEVQ
FT                   AAVAQTGAAGPQDMGKVMGVLKPKLAGRADMTAVSAQVKAALAK"
     MSLKDRINDD MKAAMRARET ERLGTVRLLL AAIKQREVDE RITLDDTAIT AVIDKMIKQR        60
     KDSISQFEAA GRTDLADKEK AELAILSAYM PEQMSEAEIV AEVQAAVAQT GAAGPQDMGK       120
     VMGVLKPKLA GRADMTAVSA QVKAALAK                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page