(data stored in ACNUC7421 zone)

EMBL: CP000271.PE207

CP000271.PE207       Location/Qualifiers
FT   CDS             244486..246528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2820"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2820"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33175"
FT                   /db_xref="GOA:Q13RW4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW4"
FT                   /protein_id="ABE33175.1"
FT                   /translation="MTKKLNEVPVDDDATQSEENPAAVPAKVEKAKARDRRAKEKALLK
FT                   DAFASSQPGTVEELEERRSKLRALIKLGKERGFLTYAEINDHLPDNFTETEAIEGIIST
FT                   FNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEDGLKHMVMAISACPTTIADILAMAERVANEEIRIDEL
FT                   VDGLIDANAEDADGFSAQEAEAIESEDEEVEEDSEEDEEEDDGTAQATANAAQMEALKR
FT                   ASLEKFAMISEWFDKMRRAFEKEGYKSKSYLKAQETIQNELMTIRFTARTVERLCDTLR
FT                   AQVDEVRQVERQILHTVVDKCGMPRAEFIARFPGSETDLEWADKIVGEGHAYSAILTRN
FT                   IPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVISIAK
FT                   KYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
FT                   IPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISMETP
FT                   IGDDDDSHLGDFIEDNNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIEMST
FT                   DHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
     MTKKLNEVPV DDDATQSEEN PAAVPAKVEK AKARDRRAKE KALLKDAFAS SQPGTVEELE        60
     ERRSKLRALI KLGKERGFLT YAEINDHLPD NFTETEAIEG IISTFNDMGV AVYEQAPDAE       120
     TLLLNDNAPA ASSDDEVEEE AEVALSTVDS EFGRTTDPVR MYMREMGTVE LLTREGEIEI       180
     AKRIEDGLKH MVMAISACPT TIADILAMAE RVANEEIRID ELVDGLIDAN AEDADGFSAQ       240
     EAEAIESEDE EVEEDSEEDE EEDDGTAQAT ANAAQMEALK RASLEKFAMI SEWFDKMRRA       300
     FEKEGYKSKS YLKAQETIQN ELMTIRFTAR TVERLCDTLR AQVDEVRQVE RQILHTVVDK       360
     CGMPRAEFIA RFPGSETDLE WADKIVGEGH AYSAILTRNI PAIREQQQRL LDLQARVVLP       420
     LKDLKETNRQ MAAGELKARQ AKREMTEANL RLVISIAKKY TNRGLQFLDL IQEGNIGLMK       480
     AVDKFEYRRG YKFSTYATWW IRQAITRSIA DQARTIRIPV HMIETINKMN RISRQILQET       540
     GLEPDPATLA EKMEMPEDKI RKIMKIAKEP ISMETPIGDD DDSHLGDFIE DNNTVAPADA       600
     ALHASMRDVV KDVLDSLTPR EAKVLRMRFG IEMSTDHTLE EVGKQFDVTR ERIRQIEAKA       660
     LRKLRHPSRS DKLKSFLEGN                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page