(data stored in ACNUC7421 zone)

EMBL: CP000271.PE209

CP000271.PE209       Location/Qualifiers
FT   CDS             248627..249043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2818"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2818"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33177"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW2"
FT                   /protein_id="ABE33177.1"
FT                   /translation="MSEQRSATAKTIGVTGRYLVESRGNFFASDSPSARDGETAAVEPS
FT                   ELLLSALGVCALGSVEKAAREFELNVRHADATVDSLRDPDDRTRFARVHIEVTVYGVTQ
FT                   PQAQRLIDHFTSGCVIYNTVRRAGPISVAVTAHP"
     MSEQRSATAK TIGVTGRYLV ESRGNFFASD SPSARDGETA AVEPSELLLS ALGVCALGSV        60
     EKAAREFELN VRHADATVDS LRDPDDRTRF ARVHIEVTVY GVTQPQAQRL IDHFTSGCVI       120
     YNTVRRAGPI SVAVTAHP                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page