(data stored in SCRATCH zone)

EMBL: CP000271.PE21

CP000271.PE21        Location/Qualifiers
FT   CDS             22380..23351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32989"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF0"
FT                   /protein_id="ABE32989.1"
FT                   /translation="MNMNKPVSKVLVLDDCPAHKEALKRFCDENNLVGVKVGKNRLQSV
FT                   LRSNIDLGAVLFAERYGGSPEASAEIAIRINAVRPELPIIMRRDNDPGMDDLPEGLQRV
FT                   VCAAYVAHDMAPLRQVIDEYIFSLDYPNALVRGIADMTQAILGDVFKDLTITCDTPHIV
FT                   RDRIIFGEVFSLIPLESAWCRGYMMMQAEETPILDLLDRHQMIDNTQRGEADFRDLNSV
FT                   LGEVTNLIWGSFRNRYVGDADAWARSQVQVPLLVNHKHKYISFGSGNPQLCFTYWLKDP
FT                   KSNRAVKLHQRFVFSLSWSPEDFTEVADDVGAMVEAGELDLF"
     MNMNKPVSKV LVLDDCPAHK EALKRFCDEN NLVGVKVGKN RLQSVLRSNI DLGAVLFAER        60
     YGGSPEASAE IAIRINAVRP ELPIIMRRDN DPGMDDLPEG LQRVVCAAYV AHDMAPLRQV       120
     IDEYIFSLDY PNALVRGIAD MTQAILGDVF KDLTITCDTP HIVRDRIIFG EVFSLIPLES       180
     AWCRGYMMMQ AEETPILDLL DRHQMIDNTQ RGEADFRDLN SVLGEVTNLI WGSFRNRYVG       240
     DADAWARSQV QVPLLVNHKH KYISFGSGNP QLCFTYWLKD PKSNRAVKLH QRFVFSLSWS       300
     PEDFTEVADD VGAMVEAGEL DLF                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page