(data stored in ACNUC7421 zone)

EMBL: CP000271.PE215

CP000271.PE215       Location/Qualifiers
FT   CDS             253988..254422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2812"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2812"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33183"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV6"
FT                   /protein_id="ABE33183.1"
FT                   /translation="MLEIQRLSVAEAAILLEGARLKATELAIPMCTAVTDESGHLITFE
FT                   RMDGGKISSISIAIDKAFTGAVARKGTHVYNQLCVPGKGTFGIHVTNGGHFSIIGGGLP
FT                   VTVNGAIVGGVGVSSGTADEDLIVAEAAVAWFRERTGFAE"
     MLEIQRLSVA EAAILLEGAR LKATELAIPM CTAVTDESGH LITFERMDGG KISSISIAID        60
     KAFTGAVARK GTHVYNQLCV PGKGTFGIHV TNGGHFSIIG GGLPVTVNGA IVGGVGVSSG       120
     TADEDLIVAE AAVAWFRERT GFAE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page