(data stored in SCRATCH zone)

EMBL: CP000271.PE219

CP000271.PE219       Location/Qualifiers
FT   CDS             257670..258887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2808"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2808"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33187"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV2"
FT                   /protein_id="ABE33187.1"
FT                   /translation="MLKEQIAATLLGLARIAAVAAATVSMAQAAQAAEAPYKLGYLVDA
FT                   SGPQSTTLKPTFDAFQLYIAQLNRAGGVNGRQVQIITRDIQSDTQRSLNAVEQLRSESV
FT                   SAVLGLGATNTHAPVYAAAQKLGLPVLASNPINIPIVLPPVKPYAFGLGQELTLAGIIG
FT                   GHFAHRLRPQGKTIACVAFEVPGSILSCNKILEQAKAEGYQRGELYTVPISQRDFRAVV
FT                   DRIVSLNPDVVADCIGREHLAALLPVLAASAYSGIFLSMDTGIGDKTLIDAVPANSKLQ
FT                   VYSFTRFVTHGDGAGPQASALRTALAAAHMPDDDASYAGGWALGLVVTDALRRCRGACG
FT                   PDALRAALENVDIDSGGLTGARLTFTPNDHYGPSAWRLYRYDAAGKSLSAVGGWQRIAS
FT                   DGKLTP"
     MLKEQIAATL LGLARIAAVA AATVSMAQAA QAAEAPYKLG YLVDASGPQS TTLKPTFDAF        60
     QLYIAQLNRA GGVNGRQVQI ITRDIQSDTQ RSLNAVEQLR SESVSAVLGL GATNTHAPVY       120
     AAAQKLGLPV LASNPINIPI VLPPVKPYAF GLGQELTLAG IIGGHFAHRL RPQGKTIACV       180
     AFEVPGSILS CNKILEQAKA EGYQRGELYT VPISQRDFRA VVDRIVSLNP DVVADCIGRE       240
     HLAALLPVLA ASAYSGIFLS MDTGIGDKTL IDAVPANSKL QVYSFTRFVT HGDGAGPQAS       300
     ALRTALAAAH MPDDDASYAG GWALGLVVTD ALRRCRGACG PDALRAALEN VDIDSGGLTG       360
     ARLTFTPNDH YGPSAWRLYR YDAAGKSLSA VGGWQRIASD GKLTP                       405
//

If you have problems or comments...

PBIL Back to PBIL home page