(data stored in ACNUC7421 zone)

EMBL: CP000271.PE22

CP000271.PE22        Location/Qualifiers
FT   CDS             23372..23737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3007"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32990"
FT                   /db_xref="GOA:Q13SE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE9"
FT                   /protein_id="ABE32990.1"
FT                   /translation="MSKILVVDDSSTVRDEVAGFLKKNGLDVDTAVDGKDGLAKLKASP
FT                   GIKLVISDVNMPNMDGLTMVEKIRGELANKTVNVIMLTTESSPAMKERGKAAGVKGWIV
FT                   KPFKGDAVLETFRKLAG"
     MSKILVVDDS STVRDEVAGF LKKNGLDVDT AVDGKDGLAK LKASPGIKLV ISDVNMPNMD        60
     GLTMVEKIRG ELANKTVNVI MLTTESSPAM KERGKAAGVK GWIVKPFKGD AVLETFRKLA       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page