(data stored in ACNUC7421 zone)

EMBL: CP000271.PE220

CP000271.PE220       Location/Qualifiers
FT   CDS             258896..259771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2807"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2807"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33188"
FT                   /db_xref="GOA:Q13RV1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV1"
FT                   /protein_id="ABE33188.1"
FT                   /translation="MNVWSFSLDLLSSAVTYALLALAVVLAWRTSRVLMFCVGEIGMTS
FT                   AYVMNGIARAAGGGVWGFALGVAGALVVAALIGWLLFALLRQLSAAGDYFVGTVVTIAV
FT                   SIFLTGLMSSVWSGETVQLPLPHPVLAWGGVTFSAVSACIVVIGAALIGVLLFAFYQSR
FT                   AGIELQAVAANWTLAVLSGIPAARWFAAVWIVASMLSAVGGISSGAISAVSISGAAVGF
FT                   SGIVAAIMGGLTSPAGALAGAFALALGENLTSLWFDARYSVAVPVVLLVLLLAMRPAGL
FT                   SGRVEHISRS"
     MNVWSFSLDL LSSAVTYALL ALAVVLAWRT SRVLMFCVGE IGMTSAYVMN GIARAAGGGV        60
     WGFALGVAGA LVVAALIGWL LFALLRQLSA AGDYFVGTVV TIAVSIFLTG LMSSVWSGET       120
     VQLPLPHPVL AWGGVTFSAV SACIVVIGAA LIGVLLFAFY QSRAGIELQA VAANWTLAVL       180
     SGIPAARWFA AVWIVASMLS AVGGISSGAI SAVSISGAAV GFSGIVAAIM GGLTSPAGAL       240
     AGAFALALGE NLTSLWFDAR YSVAVPVVLL VLLLAMRPAG LSGRVEHISR S                291
//

If you have problems or comments...

PBIL Back to PBIL home page