(data stored in SCRATCH zone)

EMBL: CP000271.PE221

CP000271.PE221       Location/Qualifiers
FT   CDS             259779..260810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2806"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2806"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33189"
FT                   /db_xref="GOA:Q13RV0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV0"
FT                   /protein_id="ABE33189.1"
FT                   /translation="MSSLQSGALEPHTRTIFPRGAVQPALLAVAIAALAAPFALGGYGL
FT                   YIASSGGVMALGAMALTVLSGSAGLPSLGTAAFMAIGAFSAGILATQWGLGMLPALLLA
FT                   LVLGFAAGAGVALLTLRVSGLYLAVGTLALQHVVQIVATDLDLKFTYASGFMLESPHIA
FT                   GLAIDTPAKWWGMTIVLLLGVYVLFRSLQRGHVGREWALLRTEPTAAATLGVSPVRARL
FT                   TVFALTSAVIAASGAIDGYRLGNVQATGYSLHLAIMYLTVVALGGAGRLVGAVVASYAI
FT                   VVLPDAIAAVLATLGIDATTRLAGIDNMLLGALLVCALLDLPARARRAILRPGAASAAR
FT                   REP"
     MSSLQSGALE PHTRTIFPRG AVQPALLAVA IAALAAPFAL GGYGLYIASS GGVMALGAMA        60
     LTVLSGSAGL PSLGTAAFMA IGAFSAGILA TQWGLGMLPA LLLALVLGFA AGAGVALLTL       120
     RVSGLYLAVG TLALQHVVQI VATDLDLKFT YASGFMLESP HIAGLAIDTP AKWWGMTIVL       180
     LLGVYVLFRS LQRGHVGREW ALLRTEPTAA ATLGVSPVRA RLTVFALTSA VIAASGAIDG       240
     YRLGNVQATG YSLHLAIMYL TVVALGGAGR LVGAVVASYA IVVLPDAIAA VLATLGIDAT       300
     TRLAGIDNML LGALLVCALL DLPARARRAI LRPGAASAAR REP                         343
//

If you have problems or comments...

PBIL Back to PBIL home page