(data stored in SCRATCH zone)

EMBL: CP000271.PE222

CP000271.PE222       Location/Qualifiers
FT   CDS             260807..261580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2805"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2805"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33190"
FT                   /db_xref="GOA:Q13RU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU9"
FT                   /protein_id="ABE33190.1"
FT                   /translation="MTEAQLMEVRALSITYGVDRAVDHVSFAIARGTSLVLAGNNGAGK
FT                   TSVLGALAGLRLRGQRVSGEAVFGGVVLRMGDIAQRIRQGVRLVPDREKVFGLLSVADN
FT                   LRIGAARTRSNAIRLDDVLGWFPRLAERRGSLAGNLSGGEQQMLGIGMALLASPQLLLL
FT                   DEPTLGLAVPVIEDLCERLARLRREAGLTMLVAESDSQWLAALADTAAVLDRGRLLRTF
FT                   GTLSRGDLGTIHDLMLGLGANGDEADRPEDRHATV"
     MTEAQLMEVR ALSITYGVDR AVDHVSFAIA RGTSLVLAGN NGAGKTSVLG ALAGLRLRGQ        60
     RVSGEAVFGG VVLRMGDIAQ RIRQGVRLVP DREKVFGLLS VADNLRIGAA RTRSNAIRLD       120
     DVLGWFPRLA ERRGSLAGNL SGGEQQMLGI GMALLASPQL LLLDEPTLGL AVPVIEDLCE       180
     RLARLRREAG LTMLVAESDS QWLAALADTA AVLDRGRLLR TFGTLSRGDL GTIHDLMLGL       240
     GANGDEADRP EDRHATV                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page