(data stored in ACNUC7421 zone)

EMBL: CP000271.PE223

CP000271.PE223       Location/Qualifiers
FT   CDS             261567..262358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2804"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2804"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33191"
FT                   /db_xref="GOA:Q13RU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU8"
FT                   /protein_id="ABE33191.1"
FT                   /translation="MQRSDPSIVLSLQRVNLSFGGLQVLRDVELCLQAGEVLALIGPNG
FT                   AGKSALLNCITGVYRPAAGSEIRLHDTRIDGLAPHRVARLGIGRTFQGLKLLRERTVLD
FT                   NILLGWTTRFSLGALGSLARPWRARREEREARERVYAMAELCGLAELRDVYCGELPLGV
FT                   LRRVDLARALLRDPDVLLLDEPASGLSHDERPLIGELVRIACQDAKRSVVWIEHDLDLV
FT                   LTEAHRAVVLHHGTVVTSDNPAQPSGRARLLTAYRKGRLTA"
     MQRSDPSIVL SLQRVNLSFG GLQVLRDVEL CLQAGEVLAL IGPNGAGKSA LLNCITGVYR        60
     PAAGSEIRLH DTRIDGLAPH RVARLGIGRT FQGLKLLRER TVLDNILLGW TTRFSLGALG       120
     SLARPWRARR EEREARERVY AMAELCGLAE LRDVYCGELP LGVLRRVDLA RALLRDPDVL       180
     LLDEPASGLS HDERPLIGEL VRIACQDAKR SVVWIEHDLD LVLTEAHRAV VLHHGTVVTS       240
     DNPAQPSGRA RLLTAYRKGR LTA                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page