(data stored in ACNUC7421 zone)

EMBL: CP000271.PE226

CP000271.PE226       Location/Qualifiers
FT   CDS             complement(264292..264858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2801"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33194"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU5"
FT                   /protein_id="ABE33194.1"
FT                   /translation="MRSHTINLLDNKEHDSMRNLHPHAMDLNGYPGNRTRPMRHAAWRI
FT                   GLRVWGFAESEVNAWIRDLPVLDGSLCWEIAHQRDGSGADMIIHLVRSSSPALGSFCWN
FT                   SVGANDAIRASRWSSRVEMALFSGDVTRLPQVRYGLWAMAGTRPAESALHTLAQAVIVP
FT                   QFLRRRVTQGTGAVRVVPRRLALVR"
     MRSHTINLLD NKEHDSMRNL HPHAMDLNGY PGNRTRPMRH AAWRIGLRVW GFAESEVNAW        60
     IRDLPVLDGS LCWEIAHQRD GSGADMIIHL VRSSSPALGS FCWNSVGAND AIRASRWSSR       120
     VEMALFSGDV TRLPQVRYGL WAMAGTRPAE SALHTLAQAV IVPQFLRRRV TQGTGAVRVV       180
     PRRLALVR                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page