(data stored in SCRATCH zone)

EMBL: CP000271.PE228

CP000271.PE228       Location/Qualifiers
FT   CDS             266423..267271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2799"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2799"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33196"
FT                   /db_xref="GOA:Q13RU3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU3"
FT                   /protein_id="ABE33196.1"
FT                   /translation="MAILDIEVISMQEERLQQAVAWLREADGLLITAGAGMGVDSGLPD
FT                   FRGNEGLWRAYPALAEAGCDFQSIANPRAFMDKPELAWGFYGHRLKLYREVEPHPGFAI
FT                   LRRWGDRLRQGAFVFTSNVDGQFQRAGFAESRIEECHGSIHYLQCTEPCFSLIESATDF
FT                   VPSIDERECRCIGPLPRCKRCGAISRPNILMFWDSAWLSSRADAQAARLAGWLRTVERL
FT                   VVVEVGAGTALPTVRRFSERHGPRVIRINAREAQIDPARGVGIEGRAVEILTAIDSGLD
FT                   V"
     MAILDIEVIS MQEERLQQAV AWLREADGLL ITAGAGMGVD SGLPDFRGNE GLWRAYPALA        60
     EAGCDFQSIA NPRAFMDKPE LAWGFYGHRL KLYREVEPHP GFAILRRWGD RLRQGAFVFT       120
     SNVDGQFQRA GFAESRIEEC HGSIHYLQCT EPCFSLIESA TDFVPSIDER ECRCIGPLPR       180
     CKRCGAISRP NILMFWDSAW LSSRADAQAA RLAGWLRTVE RLVVVEVGAG TALPTVRRFS       240
     ERHGPRVIRI NAREAQIDPA RGVGIEGRAV EILTAIDSGL DV                          282
//

If you have problems or comments...

PBIL Back to PBIL home page