(data stored in SCRATCH zone)

EMBL: CP000271.PE229

CP000271.PE229       Location/Qualifiers
FT   CDS             267596..268354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2798"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33197"
FT                   /db_xref="GOA:Q13RU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU2"
FT                   /protein_id="ABE33197.1"
FT                   /translation="MQITDTQAMQIVGFRSAYAYPAAHLVLDDHAGDFGLPGGQWAKVV
FT                   TPAQGDVTDAALDAYHERLLRSANPTERLLGTASIVFWGFYTFGPAFAAIRVHRHLFGR
FT                   GNQQITRAEQIADVLEEADTAIKAGNPGAALGMFTGINQLSRTPFASKVVALLDPRRAA
FT                   VYDNRICKGLRSSPWAANGPFANGVGSVQLRRVQREYANWCSFTQAIAEQMNEGCSRGL
FT                   AWHWRDRRDAPQSWRAIDAERAIFAMFQPD"
     MQITDTQAMQ IVGFRSAYAY PAAHLVLDDH AGDFGLPGGQ WAKVVTPAQG DVTDAALDAY        60
     HERLLRSANP TERLLGTASI VFWGFYTFGP AFAAIRVHRH LFGRGNQQIT RAEQIADVLE       120
     EADTAIKAGN PGAALGMFTG INQLSRTPFA SKVVALLDPR RAAVYDNRIC KGLRSSPWAA       180
     NGPFANGVGS VQLRRVQREY ANWCSFTQAI AEQMNEGCSR GLAWHWRDRR DAPQSWRAID       240
     AERAIFAMFQ PD                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page