(data stored in SCRATCH zone)

EMBL: CP000271.PE231

CP000271.PE231       Location/Qualifiers
FT   CDS             complement(269720..270082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2796"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33199"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU0"
FT                   /protein_id="ABE33199.1"
FT                   /translation="MLVFKRPAANGTLPGRHRNSSSQCGIQNQLIYKYAVQIKSELRSL
FT                   YLPYSYGIPHYLLETITPIHHGEKSKSTFWLRCIIHSPPHRKWRVTEKANMLADYYIRP
FT                   LHAGRIDGARSSAPCR"
     MLVFKRPAAN GTLPGRHRNS SSQCGIQNQL IYKYAVQIKS ELRSLYLPYS YGIPHYLLET        60
     ITPIHHGEKS KSTFWLRCII HSPPHRKWRV TEKANMLADY YIRPLHAGRI DGARSSAPCR       120
//

If you have problems or comments...

PBIL Back to PBIL home page