(data stored in ACNUC7421 zone)

EMBL: CP000271.PE233

CP000271.PE233       Location/Qualifiers
FT   CDS             272489..273205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2794"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2794"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33201"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT8"
FT                   /protein_id="ABE33201.1"
FT                   /translation="MKLLNGAALRTLQFGSIVLATSALVACGGGGDSPGATVSGTAAVG
FT                   QPLANAGIVLTCKNGAGSATANASGAYSATFHFDGPCAITASSGSTVLHSFAAGAGTYN
FT                   VTPLTELLLSYLAGQLGTTVSGLLSGISSNATYQGVLSNSTVVANAQAAVAQLIKTQYG
FT                   VTLSSSSFLTVSFAPGQPPDIDLDSLQTAGAITASGQPAPSLTTAVVGAGAAAPISGGG
FT                   NGGGATGGTGGSGGAT"
     MKLLNGAALR TLQFGSIVLA TSALVACGGG GDSPGATVSG TAAVGQPLAN AGIVLTCKNG        60
     AGSATANASG AYSATFHFDG PCAITASSGS TVLHSFAAGA GTYNVTPLTE LLLSYLAGQL       120
     GTTVSGLLSG ISSNATYQGV LSNSTVVANA QAAVAQLIKT QYGVTLSSSS FLTVSFAPGQ       180
     PPDIDLDSLQ TAGAITASGQ PAPSLTTAVV GAGAAAPISG GGNGGGATGG TGGSGGAT         238
//

If you have problems or comments...

PBIL Back to PBIL home page