(data stored in ACNUC7421 zone)

EMBL: CP000271.PE234

CP000271.PE234       Location/Qualifiers
FT   CDS             complement(273307..273615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2793"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2793"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33202"
FT                   /db_xref="GOA:Q13RT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT7"
FT                   /protein_id="ABE33202.1"
FT                   /translation="MGEFIPEYLIREQAALGALVLFGVLRIVAAAVAAEKSWRVSVMQG
FT                   YCILIAVLYCLPQLFDLLTHAYGMQAAAAAAELEGKAAGSAIALFFSPILSHRLGYE"
     MGEFIPEYLI REQAALGALV LFGVLRIVAA AVAAEKSWRV SVMQGYCILI AVLYCLPQLF        60
     DLLTHAYGMQ AAAAAAELEG KAAGSAIALF FSPILSHRLG YE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page