(data stored in ACNUC7421 zone)

EMBL: CP000271.PE237

CP000271.PE237       Location/Qualifiers
FT   CDS             276003..276188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2790"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33205"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT4"
FT                   /protein_id="ABE33205.1"
FT                   /translation="MHKQDIQTIVSAARETADAIVGAREWKTAEDASAMYDVIFWDMLA
FT                   KRLPDTNIADLLSMFD"
     MHKQDIQTIV SAARETADAI VGAREWKTAE DASAMYDVIF WDMLAKRLPD TNIADLLSMF        60
     D                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page