(data stored in ACNUC7421 zone)

EMBL: CP000271.PE239

CP000271.PE239       Location/Qualifiers
FT   CDS             276838..277101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2788"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33207"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT2"
FT                   /protein_id="ABE33207.1"
FT                   /translation="MARRLHKLDFRTLSITRTVMQPDHTATEFAPPPSLLATPLEGADE
FT                   STPQRQIGALARVTFCFAWLFGLEPFLTGAAGEMPLSRSDRH"
     MARRLHKLDF RTLSITRTVM QPDHTATEFA PPPSLLATPL EGADESTPQR QIGALARVTF        60
     CFAWLFGLEP FLTGAAGEMP LSRSDRH                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page