(data stored in ACNUC7421 zone)

EMBL: CP000271.PE240

CP000271.PE240       Location/Qualifiers
FT   CDS             277216..277515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2787"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33208"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT1"
FT                   /protein_id="ABE33208.1"
FT                   /translation="MCPCGTGEFAPGPVCRDEEALRRLRHKSRVTRPWAVVIRETPCEK
FT                   RHGRAVKWTRTVVRRFAVRFQHGFCHAAVGAAFHLRAMPVLKVFLFGRVTDAFK"
     MCPCGTGEFA PGPVCRDEEA LRRLRHKSRV TRPWAVVIRE TPCEKRHGRA VKWTRTVVRR        60
     FAVRFQHGFC HAAVGAAFHL RAMPVLKVFL FGRVTDAFK                               99
//

If you have problems or comments...

PBIL Back to PBIL home page