(data stored in ACNUC7421 zone)

EMBL: CP000271.PE244

CP000271.PE244       Location/Qualifiers
FT   CDS             complement(281890..282636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2783"
FT                   /product="Cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2783"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33212"
FT                   /db_xref="GOA:Q13RS7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS7"
FT                   /protein_id="ABE33212.1"
FT                   /translation="MNDAPLTAPADARPNRRERVARADLPGLFATCAWFRALAAEHQAL
FT                   VVASAHAEHMEGGAWIARRQEPSDYWIGVHSGLLKLAIYNASGRSCTLSGVPPGGWFGE
FT                   GSVIKRELRKYDVAAIQPSLVMFVPSDTFHALLESSLPFTGFVIRQLNNRMGEFIASIQ
FT                   NSRLLDVDARVAQSLAQLFNPDLYPDTGRALAISQEEVGLLAGVSRQRINQALQNLERL
FT                   QILRLSYNQIHVLDLERLTAFGREQI"
     MNDAPLTAPA DARPNRRERV ARADLPGLFA TCAWFRALAA EHQALVVASA HAEHMEGGAW        60
     IARRQEPSDY WIGVHSGLLK LAIYNASGRS CTLSGVPPGG WFGEGSVIKR ELRKYDVAAI       120
     QPSLVMFVPS DTFHALLESS LPFTGFVIRQ LNNRMGEFIA SIQNSRLLDV DARVAQSLAQ       180
     LFNPDLYPDT GRALAISQEE VGLLAGVSRQ RINQALQNLE RLQILRLSYN QIHVLDLERL       240
     TAFGREQI                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page