(data stored in SCRATCH zone)

EMBL: CP000271.PE246

CP000271.PE246       Location/Qualifiers
FT   CDS             complement(284555..284779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2781"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33214"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS5"
FT                   /protein_id="ABE33214.1"
FT                   /translation="MQNTPIHHYNGYAVKPSAHRLPDGTFSSNLLLERADSARAEGRYQ
FT                   FYSLDYFTNEEQALQHSASWARHWVDTRG"
     MQNTPIHHYN GYAVKPSAHR LPDGTFSSNL LLERADSARA EGRYQFYSLD YFTNEEQALQ        60
     HSASWARHWV DTRG                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page