(data stored in SCRATCH zone)

EMBL: CP000271.PE247

CP000271.PE247       Location/Qualifiers
FT   CDS             complement(285068..285271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2780"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2780"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33215"
FT                   /db_xref="GOA:Q13RS4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS4"
FT                   /protein_id="ABE33215.1"
FT                   /translation="MDTGTVKWFNDSKGFGFITPDKGGDDLFAHFSEISGDGFKTLAEN
FT                   QKVSFETKQGPKGLQAANIKPM"
     MDTGTVKWFN DSKGFGFITP DKGGDDLFAH FSEISGDGFK TLAENQKVSF ETKQGPKGLQ        60
     AANIKPM                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page