(data stored in ACNUC7421 zone)

EMBL: CP000271.PE248

CP000271.PE248       Location/Qualifiers
FT   CDS             complement(285567..286202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2779"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2779"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33216"
FT                   /db_xref="GOA:Q13RS3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS3"
FT                   /protein_id="ABE33216.1"
FT                   /translation="MSASTAIIAILAALLVGAMSPGPSFVIVARNAIGLSRGDGLATAI
FT                   GMGVGGVFFSGIALLGLYTLLASVEWLYVGLKVAGGLYLIYLASKIWRGAAKPLAFDTT
FT                   QAVPANARKSFWIGLSTQLSNPKTAVYYGSIFAALLPQHPPLWCYFALPPAIFAIEAGW
FT                   YTVVALCFSSKRPREIYLQWKAWVDRVAASAVAALGLRLILTAHKVGI"
     MSASTAIIAI LAALLVGAMS PGPSFVIVAR NAIGLSRGDG LATAIGMGVG GVFFSGIALL        60
     GLYTLLASVE WLYVGLKVAG GLYLIYLASK IWRGAAKPLA FDTTQAVPAN ARKSFWIGLS       120
     TQLSNPKTAV YYGSIFAALL PQHPPLWCYF ALPPAIFAIE AGWYTVVALC FSSKRPREIY       180
     LQWKAWVDRV AASAVAALGL RLILTAHKVG I                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page