(data stored in SCRATCH zone)

EMBL: CP000271.PE249

CP000271.PE249       Location/Qualifiers
FT   CDS             286332..286628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2778"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33217"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS2"
FT                   /protein_id="ABE33217.1"
FT                   /translation="MSNTACTRSIAKPAGIEKQRVAGSPVRCSGQKKLDARMTFHTLKQ
FT                   PRTTRQDKSAIRSGCRRVPPNAGFIGHDFQVRVLTHRNRHREFDSHSIHLNHA"
     MSNTACTRSI AKPAGIEKQR VAGSPVRCSG QKKLDARMTF HTLKQPRTTR QDKSAIRSGC        60
     RRVPPNAGFI GHDFQVRVLT HRNRHREFDS HSIHLNHA                                98
//

If you have problems or comments...

PBIL Back to PBIL home page