(data stored in SCRATCH zone)

EMBL: CP000271.PE25

CP000271.PE25        Location/Qualifiers
FT   CDS             complement(26152..27111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3004"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32993"
FT                   /db_xref="GOA:Q13SE6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE6"
FT                   /protein_id="ABE32993.1"
FT                   /translation="MPTVAIAIFPGVQALDVAGPVDVFSEANRFIAPNNRYEVTLLGAE
FT                   STPLRASNGMTLVADATFSEARHTFDLALIAGGPALPERAPDARVLDWLANAASQCGRY
FT                   GSICTGAFALGHAGLLDGHNVTTHWQHAAQLAAQFPNARVDFDRIYLRDGPLVTSAGVT
FT                   AGIDLSLALVAEDHGPQIALAVAKRLVVFAQRQGGQSQFSPYLTAPADETSPVAKVQAH
FT                   VMERIRESFTVKQLADVAGMSARNFARVFVQETGVTPHEFVERARVDAARKLLESSGAA
FT                   LKAIAYDCGFGTADRMRIVFTKRIGATPMQYRERFRSP"
     MPTVAIAIFP GVQALDVAGP VDVFSEANRF IAPNNRYEVT LLGAESTPLR ASNGMTLVAD        60
     ATFSEARHTF DLALIAGGPA LPERAPDARV LDWLANAASQ CGRYGSICTG AFALGHAGLL       120
     DGHNVTTHWQ HAAQLAAQFP NARVDFDRIY LRDGPLVTSA GVTAGIDLSL ALVAEDHGPQ       180
     IALAVAKRLV VFAQRQGGQS QFSPYLTAPA DETSPVAKVQ AHVMERIRES FTVKQLADVA       240
     GMSARNFARV FVQETGVTPH EFVERARVDA ARKLLESSGA ALKAIAYDCG FGTADRMRIV       300
     FTKRIGATPM QYRERFRSP                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page