(data stored in SCRATCH zone)

EMBL: CP000271.PE250

CP000271.PE250       Location/Qualifiers
FT   CDS             286700..286963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2777"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33218"
FT                   /db_xref="GOA:Q13RS1"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS1"
FT                   /protein_id="ABE33218.1"
FT                   /translation="MKEREEQRLFDLDGNARERLIVWIRRRMDEYGITMEALAEAIEAD
FT                   ASATRAVMYRDAYGNTWDGHGDKPDWLARAIYAGQSMDHFRC"
     MKEREEQRLF DLDGNARERL IVWIRRRMDE YGITMEALAE AIEADASATR AVMYRDAYGN        60
     TWDGHGDKPD WLARAIYAGQ SMDHFRC                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page