(data stored in SCRATCH zone)

EMBL: CP000271.PE251

CP000271.PE251       Location/Qualifiers
FT   CDS             complement(287144..287731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2776"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="Protocatechuate pathway; Citation: Biochem. Biophys.
FT                   Res. Commun. 295 (4), 903-909 (2002)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2776"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33219"
FT                   /db_xref="GOA:Q13RS0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS0"
FT                   /protein_id="ABE33219.1"
FT                   /translation="MTTLKQTPSQTVGPYFAYGLCPQQYDFDFRSLFTPVVADREAAGE
FT                   HITIVGQVFDGDGKVIGDAMLEVSQVDANGRFPESREEILKTGFRGFARVGTGTDPHKR
FT                   FVVETVKPGRVGPDEAPHLNVVVTMRGMLLHTFTRIYFEDETAANEKDPVLTAVPADRR
FT                   DTLIARREPNVANIYRFDIHMQGEKETVFFDL"
     MTTLKQTPSQ TVGPYFAYGL CPQQYDFDFR SLFTPVVADR EAAGEHITIV GQVFDGDGKV        60
     IGDAMLEVSQ VDANGRFPES REEILKTGFR GFARVGTGTD PHKRFVVETV KPGRVGPDEA       120
     PHLNVVVTMR GMLLHTFTRI YFEDETAANE KDPVLTAVPA DRRDTLIARR EPNVANIYRF       180
     DIHMQGEKET VFFDL                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page