(data stored in ACNUC7421 zone)

EMBL: CP000271.PE252

CP000271.PE252       Location/Qualifiers
FT   CDS             complement(287735..288439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2775"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="Protocatechuate pathway; Citation: Biochem. Biophys.
FT                   Res. Commun. 295 (4), 903-909 (2002)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2775"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33220"
FT                   /db_xref="GOA:Q13RR9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR9"
FT                   /protein_id="ABE33220.1"
FT                   /translation="MDESFLTARDFASHPSYIYPGYGSSVKRGPTRPLIPLKEKLRDQH
FT                   VPVYGTEDLGALDHDLTRNAVRNGEPLGERIIVTGRVLDEGNRPVRNTLVEIWQANAAG
FT                   RYVHKADQHDAPLDPNFLGAGRCITDNEGRYRFMTIKPGAYPWGNHPNAWRPNHIHFSL
FT                   FGDHFGSRLVTQMYFPGDPLLAFDPIFQGTPEHARDRLIANFSLDTTQEAYALGYDFDI
FT                   VLRGRNETPMER"
     MDESFLTARD FASHPSYIYP GYGSSVKRGP TRPLIPLKEK LRDQHVPVYG TEDLGALDHD        60
     LTRNAVRNGE PLGERIIVTG RVLDEGNRPV RNTLVEIWQA NAAGRYVHKA DQHDAPLDPN       120
     FLGAGRCITD NEGRYRFMTI KPGAYPWGNH PNAWRPNHIH FSLFGDHFGS RLVTQMYFPG       180
     DPLLAFDPIF QGTPEHARDR LIANFSLDTT QEAYALGYDF DIVLRGRNET PMER             234
//

If you have problems or comments...

PBIL Back to PBIL home page