(data stored in SCRATCH zone)

EMBL: CP000271.PE256

CP000271.PE256       Location/Qualifiers
FT   CDS             292120..293157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2771"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2771"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33224"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR5"
FT                   /protein_id="ABE33224.1"
FT                   /translation="MRNIKNANVEQLLLKLLGADKTARLFATLNHPQILNEWEAGIVTR
FT                   AELAQAMNMALFEDLLARSANGRRYTEEAVAAGGSVYFDHGALRTVRWPHSGALPMGEA
FT                   AFARILRPLGFSINGRYPLDRLGMTGRAWAHDDAPDEIAQFFVSELHPERFSAEFQQAV
FT                   TNVIGESRDPLTPRALGQLWELERDGVLPLDAAHELLPVMVGAFACQHETPREADYEVL
FT                   LKESAEMAWIATEGNAFNHATDRVADVFQLSDDEKAKGRPMKPEVERSRSGRVFQTAYR
FT                   ADTVLREFRAADASIVTREVPGSFYEFITRKRTFDQDARRWETDLRFDAGNAQGIFKMT
FT                   ANQAA"
     MRNIKNANVE QLLLKLLGAD KTARLFATLN HPQILNEWEA GIVTRAELAQ AMNMALFEDL        60
     LARSANGRRY TEEAVAAGGS VYFDHGALRT VRWPHSGALP MGEAAFARIL RPLGFSINGR       120
     YPLDRLGMTG RAWAHDDAPD EIAQFFVSEL HPERFSAEFQ QAVTNVIGES RDPLTPRALG       180
     QLWELERDGV LPLDAAHELL PVMVGAFACQ HETPREADYE VLLKESAEMA WIATEGNAFN       240
     HATDRVADVF QLSDDEKAKG RPMKPEVERS RSGRVFQTAY RADTVLREFR AADASIVTRE       300
     VPGSFYEFIT RKRTFDQDAR RWETDLRFDA GNAQGIFKMT ANQAA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page