(data stored in SCRATCH zone)

EMBL: CP000271.PE259

CP000271.PE259       Location/Qualifiers
FT   CDS             complement(297066..297806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2768"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2768"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33227"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR2"
FT                   /protein_id="ABE33227.1"
FT                   /translation="MKTTNRHHTMHLIHATSPRHTAMRISFLHTMDGNRQVFEQAAKTL
FT                   GMRAEDLHHEVRADLREAVTQTGTFSSELKAETNQRLLALAAHSDAVILTCATLGPAVA
FT                   DIGHSPVPIVRADIALAAAAAEAGGKIVVLCAAESAVESTRKLFVEQASGNNASVEVVH
FT                   LPEVWALFKAGALDACLAAIALAADDAYEAGATVVAFAHPWMAPGADLVRKGRRPLDSP
FT                   SAALRAAAQRFSESSASSAKASFR"
     MKTTNRHHTM HLIHATSPRH TAMRISFLHT MDGNRQVFEQ AAKTLGMRAE DLHHEVRADL        60
     REAVTQTGTF SSELKAETNQ RLLALAAHSD AVILTCATLG PAVADIGHSP VPIVRADIAL       120
     AAAAAEAGGK IVVLCAAESA VESTRKLFVE QASGNNASVE VVHLPEVWAL FKAGALDACL       180
     AAIALAADDA YEAGATVVAF AHPWMAPGAD LVRKGRRPLD SPSAALRAAA QRFSESSASS       240
     AKASFR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page