(data stored in SCRATCH zone)

EMBL: CP000271.PE260

CP000271.PE260       Location/Qualifiers
FT   CDS             298103..300427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2767"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33228"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR1"
FT                   /protein_id="ABE33228.1"
FT                   /translation="MSTDADTITDEQIAAIADRMVEEGRRVSPVTIWKEVRGGSLVAIV
FT                   AALQRWREARQGETPALQVQPGLPEGLAETVMSAADRIWSASQHDAERAFSQRLAAVNQ
FT                   DLEAAVAERDEALAEYQKMIDEVETGRQRVIALTDTLSASESIALRLEAELATVTGRAE
FT                   AAETHVEELAQRASAQDADLEAMKASLDKERLAREESATALASKNDEVAQLTQERDQAR
FT                   HEIVTLSDVCHARTEEVTQWSQEARAASSRAELAEARIEELVQRAAVDHANLEAMNASL
FT                   EAERKAREELAAVVSSKTDELTRVVQEREQALQQVTTLDAACRANAQEVTRWSQEANAA
FT                   TSRAQAAEARIEELVQRVSSQDAGLEAAKASLEEERKGHEELAAVVSGKTDELTRVTQE
FT                   RDQALQQVTTLDAACQANAQEVTRWSQEANAATSRAQAAEVRIEELLQHATSQAAEQQA
FT                   TVALLDEERKARAELATAISGKSDELAQAAQERDQAQQQIVTLSDAHQAKSEEAIRLST
FT                   ELGAALSHAKAAEVQASGSLAKLAALEAELEQARAALAAEREAAAARADQMSVHLNDLQ
FT                   RVTQELEETRQQIATMNEAKAAASADLARVSQDASAAKERAEAAEQQVVQLEQRLAAQA
FT                   AAIAQQNQRAQQASVRADEAERAEEVAALQRQIAAQARANAKALSELRATAEQWVAHAK
FT                   DLKQRLGLASERILFIDARSTGEVALVRRLSSELERLKPDHELIARETQQKLIGATMSH
FT                   QLAQKGYRYDPATAVMSKVTA"
     MSTDADTITD EQIAAIADRM VEEGRRVSPV TIWKEVRGGS LVAIVAALQR WREARQGETP        60
     ALQVQPGLPE GLAETVMSAA DRIWSASQHD AERAFSQRLA AVNQDLEAAV AERDEALAEY       120
     QKMIDEVETG RQRVIALTDT LSASESIALR LEAELATVTG RAEAAETHVE ELAQRASAQD       180
     ADLEAMKASL DKERLAREES ATALASKNDE VAQLTQERDQ ARHEIVTLSD VCHARTEEVT       240
     QWSQEARAAS SRAELAEARI EELVQRAAVD HANLEAMNAS LEAERKAREE LAAVVSSKTD       300
     ELTRVVQERE QALQQVTTLD AACRANAQEV TRWSQEANAA TSRAQAAEAR IEELVQRVSS       360
     QDAGLEAAKA SLEEERKGHE ELAAVVSGKT DELTRVTQER DQALQQVTTL DAACQANAQE       420
     VTRWSQEANA ATSRAQAAEV RIEELLQHAT SQAAEQQATV ALLDEERKAR AELATAISGK       480
     SDELAQAAQE RDQAQQQIVT LSDAHQAKSE EAIRLSTELG AALSHAKAAE VQASGSLAKL       540
     AALEAELEQA RAALAAEREA AAARADQMSV HLNDLQRVTQ ELEETRQQIA TMNEAKAAAS       600
     ADLARVSQDA SAAKERAEAA EQQVVQLEQR LAAQAAAIAQ QNQRAQQASV RADEAERAEE       660
     VAALQRQIAA QARANAKALS ELRATAEQWV AHAKDLKQRL GLASERILFI DARSTGEVAL       720
     VRRLSSELER LKPDHELIAR ETQQKLIGAT MSHQLAQKGY RYDPATAVMS KVTA             774
//

If you have problems or comments...

PBIL Back to PBIL home page