(data stored in SCRATCH zone)

EMBL: CP000271.PE261

CP000271.PE261       Location/Qualifiers
FT   CDS             complement(300508..301533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2766"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2766"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33229"
FT                   /db_xref="GOA:Q13RR0"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR0"
FT                   /protein_id="ABE33229.1"
FT                   /translation="MNLKQLTLILCALCASAAHAADITGAGSTFAAPIYTKWADAYQKT
FT                   GGGKVNYQGIGSSGGIKQILAKTVDFAGSDAPLKDDELAKDGLFQFPTVVGGVVPAINV
FT                   PGLKAGELVLSGEVLGDIYLGKIKKWNDPQIAALNPKIKLPDTDIAVVRRADGSGTSFI
FT                   WTNYLSKVNPEWKSKVGEGATVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKQNH
FT                   MTYASMKNASGTIVEPTTDTFKAAAAGADWSKSFYQILTNEPGKNAWPVVGATFVLLYT
FT                   TQDKAAQGAETLKFFDWAFRNGGKAADDLDYISLPESVTAEIRAQWKQKVKDASGKPVA
FT                   P"
     MNLKQLTLIL CALCASAAHA ADITGAGSTF AAPIYTKWAD AYQKTGGGKV NYQGIGSSGG        60
     IKQILAKTVD FAGSDAPLKD DELAKDGLFQ FPTVVGGVVP AINVPGLKAG ELVLSGEVLG       120
     DIYLGKIKKW NDPQIAALNP KIKLPDTDIA VVRRADGSGT SFIWTNYLSK VNPEWKSKVG       180
     EGATVNWPTG TGGKGNDGVA AFVQRLPGAI GYVEWAYAKQ NHMTYASMKN ASGTIVEPTT       240
     DTFKAAAAGA DWSKSFYQIL TNEPGKNAWP VVGATFVLLY TTQDKAAQGA ETLKFFDWAF       300
     RNGGKAADDL DYISLPESVT AEIRAQWKQK VKDASGKPVA P                           341
//

If you have problems or comments...

PBIL Back to PBIL home page