(data stored in SCRATCH zone)

EMBL: CP000271.PE262

CP000271.PE262       Location/Qualifiers
FT   CDS             301843..302880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2765"
FT                   /product="Mg2+ transporter protein, CorA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2765"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33230"
FT                   /db_xref="GOA:Q13RQ9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ9"
FT                   /protein_id="ABE33230.1"
FT                   /translation="MKSDLLLQTYGADSSGMVCGFLFSSMRAGRPVDADEVVEWLQAHD
FT                   ANGPPKESSEFLWLHFNLAHSASERWMRTQLDLPETFFDALREGSHSTRIEHADGALRA
FT                   VVNDVMFNLEFIPSEIATLWIYANQRIIVTARLKPLRSVDRLRASVRQGEVFRSPAELL
FT                   VHLMRDQADLLVQIVRRTSADVDRIEDRFLSQRPTQNRIDLGAMRRMLTRLQRMLAPEP
FT                   GAIFRLLARPPRWLHSEDVQDLRESTEEFSVVLSDVAGLIERVRLLQEEIISRLEEQNN
FT                   RTLFTLTLVTVLAMPINIVAGFFGMNVGGIPLAENRHGFWVMVLLVAGFTGLAGWWAFR
FT                   RRKER"
     MKSDLLLQTY GADSSGMVCG FLFSSMRAGR PVDADEVVEW LQAHDANGPP KESSEFLWLH        60
     FNLAHSASER WMRTQLDLPE TFFDALREGS HSTRIEHADG ALRAVVNDVM FNLEFIPSEI       120
     ATLWIYANQR IIVTARLKPL RSVDRLRASV RQGEVFRSPA ELLVHLMRDQ ADLLVQIVRR       180
     TSADVDRIED RFLSQRPTQN RIDLGAMRRM LTRLQRMLAP EPGAIFRLLA RPPRWLHSED       240
     VQDLRESTEE FSVVLSDVAG LIERVRLLQE EIISRLEEQN NRTLFTLTLV TVLAMPINIV       300
     AGFFGMNVGG IPLAENRHGF WVMVLLVAGF TGLAGWWAFR RRKER                       345
//

If you have problems or comments...

PBIL Back to PBIL home page