(data stored in SCRATCH zone)

EMBL: CP000271.PE263

CP000271.PE263       Location/Qualifiers
FT   CDS             complement(302949..303875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2764"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2764"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33231"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ8"
FT                   /protein_id="ABE33231.1"
FT                   /translation="MRDVASTQERTSDNAGRRTSTVSANMSPAAAFSTLVTPMVATVAQ
FT                   RVGTLCVSADPESLHKLRVVLRRLRSLWWAYDPLIDGSQARRQRREFKALADSAGQTRD
FT                   WDILKHLLADDAQMPHSFAALIERVDLLRGDALLHSRTTIAAANVEALLAQGIADVMLQ
FT                   LEARPFDEPLVGFAADRIATAKKALRKRMKRLLRDQHAGYAEFHEVRIAAKKVRYLLEF
FT                   FAPLIDSGNGIGIVELTQMQDELGKLNDIVSSESLLLVHKDRLGECGMVDDAIAYLRYL
FT                   KGHHMQSADASLRAVGDMLASEHSGSD"
     MRDVASTQER TSDNAGRRTS TVSANMSPAA AFSTLVTPMV ATVAQRVGTL CVSADPESLH        60
     KLRVVLRRLR SLWWAYDPLI DGSQARRQRR EFKALADSAG QTRDWDILKH LLADDAQMPH       120
     SFAALIERVD LLRGDALLHS RTTIAAANVE ALLAQGIADV MLQLEARPFD EPLVGFAADR       180
     IATAKKALRK RMKRLLRDQH AGYAEFHEVR IAAKKVRYLL EFFAPLIDSG NGIGIVELTQ       240
     MQDELGKLND IVSSESLLLV HKDRLGECGM VDDAIAYLRY LKGHHMQSAD ASLRAVGDML       300
     ASEHSGSD                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page