(data stored in ACNUC7421 zone)

EMBL: CP000271.PE265

CP000271.PE265       Location/Qualifiers
FT   CDS             305732..306766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2762"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2762"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33233"
FT                   /db_xref="GOA:Q13RQ6"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ6"
FT                   /protein_id="ABE33233.1"
FT                   /translation="MSYTQTLLTGVVGALLAVTAHGADIAGAGSTFAAPIYTKWAGAYQ
FT                   QAGGGAVSYRAVGSTEGVKEIMESQVDFAGSDAPLSDDELARNGLLQFPMVIGGVVPVV
FT                   NLPGIKPGELILSGRVLADIYLGKIINWDAPAIAAINPRIKLPDTPIAVVRRLDGSGTT
FT                   LIWTHYLAQANSEWKSRIGEGTSVRWPRGIGGRGNEGVATFVQHLPGAIGYVAWDFTKQ
FT                   NHMSYTAMENASGAVVQPGPETFKAAAASADWSRSLFPILTNEPGANAWPVVGATYVLL
FT                   HSTQNKPERGEATLKFLEWALTNGDQAAEDLDYVPLPPPVVSEIRTQLHARVKNPSGKA
FT                   IAGE"
     MSYTQTLLTG VVGALLAVTA HGADIAGAGS TFAAPIYTKW AGAYQQAGGG AVSYRAVGST        60
     EGVKEIMESQ VDFAGSDAPL SDDELARNGL LQFPMVIGGV VPVVNLPGIK PGELILSGRV       120
     LADIYLGKII NWDAPAIAAI NPRIKLPDTP IAVVRRLDGS GTTLIWTHYL AQANSEWKSR       180
     IGEGTSVRWP RGIGGRGNEG VATFVQHLPG AIGYVAWDFT KQNHMSYTAM ENASGAVVQP       240
     GPETFKAAAA SADWSRSLFP ILTNEPGANA WPVVGATYVL LHSTQNKPER GEATLKFLEW       300
     ALTNGDQAAE DLDYVPLPPP VVSEIRTQLH ARVKNPSGKA IAGE                        344
//

If you have problems or comments...

PBIL Back to PBIL home page