(data stored in ACNUC7421 zone)

EMBL: CP000271.PE266

CP000271.PE266       Location/Qualifiers
FT   CDS             complement(306816..307247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2761"
FT                   /product="Putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2761"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33234"
FT                   /db_xref="GOA:Q13RQ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ5"
FT                   /protein_id="ABE33234.1"
FT                   /translation="MQNAIDFQQLANAIGDAIIISDSQGSITFWNPAAERMFGFTQDEA
FT                   LGNSLDLIIPERLRGRHWDGYHKTMTTGETRYGNDVLRVPSVHKDGRSMSIAFTVALLH
FT                   SPDNELTGIVAVIRDETSRFQEDRLLRKRLAELEASAGA"
     MQNAIDFQQL ANAIGDAIII SDSQGSITFW NPAAERMFGF TQDEALGNSL DLIIPERLRG        60
     RHWDGYHKTM TTGETRYGND VLRVPSVHKD GRSMSIAFTV ALLHSPDNEL TGIVAVIRDE       120
     TSRFQEDRLL RKRLAELEAS AGA                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page