(data stored in ACNUC7421 zone)

EMBL: CP000271.PE270

CP000271.PE270       Location/Qualifiers
FT   CDS             312153..312590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2757"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33238"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ1"
FT                   /protein_id="ABE33238.1"
FT                   /translation="MRASILGRATCLKEMTMNHAQLNAGDSVHDAEIDAQLCAYNAAFD
FT                   ELGLRFRWDAQTLTSLAVIDGERAQIAAYIESHHPHLLKAYSAEFLSQAILDRKSARYP
FT                   APLPRRVGSASLSTHAVRQSGTSSRRERVSYDIELPALAGV"
     MRASILGRAT CLKEMTMNHA QLNAGDSVHD AEIDAQLCAY NAAFDELGLR FRWDAQTLTS        60
     LAVIDGERAQ IAAYIESHHP HLLKAYSAEF LSQAILDRKS ARYPAPLPRR VGSASLSTHA       120
     VRQSGTSSRR ERVSYDIELP ALAGV                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page