(data stored in SCRATCH zone)

EMBL: CP000271.PE271

CP000271.PE271       Location/Qualifiers
FT   CDS             complement(312752..313102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2756"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2756"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33239"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ0"
FT                   /protein_id="ABE33239.1"
FT                   /translation="MKKALVYLVLAASALSAPVFAFAQSNGPVTRAEVRSDLVKLEQAG
FT                   YNPAQGNDANYPTDIQAAEAKVAAQTSQQLATQGYGGVTQNGSSSSGGPARVAMHSTCV
FT                   GPVSFCTPYFGS"
     MKKALVYLVL AASALSAPVF AFAQSNGPVT RAEVRSDLVK LEQAGYNPAQ GNDANYPTDI        60
     QAAEAKVAAQ TSQQLATQGY GGVTQNGSSS SGGPARVAMH STCVGPVSFC TPYFGS           116
//

If you have problems or comments...

PBIL Back to PBIL home page