(data stored in ACNUC7421 zone)

EMBL: CP000271.PE272

CP000271.PE272       Location/Qualifiers
FT   CDS             complement(313326..313913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2755"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2755"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33240"
FT                   /db_xref="GOA:Q13RP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP9"
FT                   /protein_id="ABE33240.1"
FT                   /translation="MEERIKHLLNQISVLESELQAELHQREVKLFYRITGKHVEFDKAV
FT                   GKAHRELKVGIVRWILSSRPQNFLAAPFVYGLVFPLVFLDLCISIYQAICFPIYGIAKV
FT                   KRADYIVMDRWQLHYLNFMERFHCAYCEYANGLIAYASEIAARTEQYWCPIKHARKVLG
FT                   THARYERFLAYGEAEQYQERLAQFRDALRKQQ"
     MEERIKHLLN QISVLESELQ AELHQREVKL FYRITGKHVE FDKAVGKAHR ELKVGIVRWI        60
     LSSRPQNFLA APFVYGLVFP LVFLDLCISI YQAICFPIYG IAKVKRADYI VMDRWQLHYL       120
     NFMERFHCAY CEYANGLIAY ASEIAARTEQ YWCPIKHARK VLGTHARYER FLAYGEAEQY       180
     QERLAQFRDA LRKQQ                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page