(data stored in ACNUC7421 zone)

EMBL: CP000271.PE275

CP000271.PE275       Location/Qualifiers
FT   CDS             315530..316786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2752"
FT                   /product="terephthalate 1,2-dioxygenase, alpha subunit"
FT                   /function="Rieske-type bacterial ring
FT                   hydroxylatingdioxygenase, alpha subunit"
FT                   /note="Citation: FEMS Microbiol. Lett. 220 (2), 255-
FT                   260(2003); Terephthalate degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2752"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33243"
FT                   /db_xref="GOA:Q13RP6"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP6"
FT                   /protein_id="ABE33243.1"
FT                   /translation="MRARRASITWPSEGLTRVPYALFQDEGVYADEQDAIFRGPNWSYL
FT                   CLEAEVPNQGDFRSTFVGDAPVVVTRDTDGEIYAFENRCAHRGAMVCLEDQGNARDFSC
FT                   VYHAWTYSLQGDLVGVAFKDGIDGKGGMKPDFCTGDHGLRKLRVATLHGLVFGSFSDDV
FT                   PPLDEYLGEEIVERIARVLENRKPVVLGRFTQMLPNNWKLYFENVKDSYHASILHLFFT
FT                   TFQLNRLSQRGGIIVDPSGGHHVSYSAVDHAAEAAAQRKATSDYADQKIRSESEHRLED
FT                   TSVLAGVDEFGDGVTLQILSVFPGFVLQQIQNAIAVRQILPRGTQQTELNWTYLGFEDD
FT                   TPELREMRLRQSNLVGPAGYVSMEDGCVGGFVQRGIEGAGDGRSVIEMGGDSAESSASR
FT                   VTEASIRGFWKAYRNAMGY"
     MRARRASITW PSEGLTRVPY ALFQDEGVYA DEQDAIFRGP NWSYLCLEAE VPNQGDFRST        60
     FVGDAPVVVT RDTDGEIYAF ENRCAHRGAM VCLEDQGNAR DFSCVYHAWT YSLQGDLVGV       120
     AFKDGIDGKG GMKPDFCTGD HGLRKLRVAT LHGLVFGSFS DDVPPLDEYL GEEIVERIAR       180
     VLENRKPVVL GRFTQMLPNN WKLYFENVKD SYHASILHLF FTTFQLNRLS QRGGIIVDPS       240
     GGHHVSYSAV DHAAEAAAQR KATSDYADQK IRSESEHRLE DTSVLAGVDE FGDGVTLQIL       300
     SVFPGFVLQQ IQNAIAVRQI LPRGTQQTEL NWTYLGFEDD TPELREMRLR QSNLVGPAGY       360
     VSMEDGCVGG FVQRGIEGAG DGRSVIEMGG DSAESSASRV TEASIRGFWK AYRNAMGY         418
//

If you have problems or comments...

PBIL Back to PBIL home page