(data stored in SCRATCH zone)

EMBL: CP000271.PE276

CP000271.PE276       Location/Qualifiers
FT   CDS             316789..317259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2751"
FT                   /product="terephthalate 1,2-dioxygenase, beta subunit"
FT                   /EC_number="1.14.12.15"
FT                   /note="Terephthalate degradation; Citation: Environ. Health
FT                   Perspect. 103, 9-12(1995)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2751"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33244"
FT                   /db_xref="GOA:Q13RP5"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP5"
FT                   /protein_id="ABE33244.1"
FT                   /translation="MAQDIYQLIARAQADYVRCIDDGDLAQWPDFFTDACVYRVTTADN
FT                   YRRGLTGSMIYAASRGMLVDRIASLRGANIYERHSYRHLLGQPSVISAAEREARSETSF
FT                   MVARIMRDGSTSLFATGRYCDVYAVEENGVRLRERIVVCDSSRIDTLLALPL"
     MAQDIYQLIA RAQADYVRCI DDGDLAQWPD FFTDACVYRV TTADNYRRGL TGSMIYAASR        60
     GMLVDRIASL RGANIYERHS YRHLLGQPSV ISAAEREARS ETSFMVARIM RDGSTSLFAT       120
     GRYCDVYAVE ENGVRLRERI VVCDSSRIDT LLALPL                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page