(data stored in ACNUC7421 zone)

EMBL: CP000271.PE283

CP000271.PE283       Location/Qualifiers
FT   CDS             complement(324317..325063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2744"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33251"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN8"
FT                   /protein_id="ABE33251.1"
FT                   /translation="MAAITSPRQHRMPDTLTSYFWSGDAIRSRRVSDIVLSGSLDVPVP
FT                   PLRLLADWEREISSHMVLEAGDVEPMPLARARARWPDYSRCVQAVSDWMCALGLPGVLA
FT                   SSDVALMACRGARYHHDAAQYGSAAFCNLFMSEDKGLDLHFPALGHRIPLTRGTVVIFD
FT                   TAQPHGVIQRGSSGFDAADFAPGQDCIQIFLTWELPIEDAHVAHALEVAFDTAPSTSSQ
FT                   LDAEQVQLNGEQVIVCPASGRWRPSD"
     MAAITSPRQH RMPDTLTSYF WSGDAIRSRR VSDIVLSGSL DVPVPPLRLL ADWEREISSH        60
     MVLEAGDVEP MPLARARARW PDYSRCVQAV SDWMCALGLP GVLASSDVAL MACRGARYHH       120
     DAAQYGSAAF CNLFMSEDKG LDLHFPALGH RIPLTRGTVV IFDTAQPHGV IQRGSSGFDA       180
     ADFAPGQDCI QIFLTWELPI EDAHVAHALE VAFDTAPSTS SQLDAEQVQL NGEQVIVCPA       240
     SGRWRPSD                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page