(data stored in SCRATCH zone)

EMBL: CP000271.PE287

CP000271.PE287       Location/Qualifiers
FT   CDS             330601..331788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2740"
FT                   /product="Putative lipid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2740"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33255"
FT                   /db_xref="GOA:Q13RN4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN4"
FT                   /protein_id="ABE33255.1"
FT                   /translation="MSEKVLVAGVGMIQFAKPGASQSYTEMGAEATRRALADAGIAYDL
FT                   VQQAFAGYVYGDSTCGQTAIYEVGMTGIPIVNVNNNCSTGSTALYLARQAIATGDADCV
FT                   LALGFEQMQAGALKSHWDDRPVTRARFVPIMHGLTADLAHLPQALRTFGGAGREHMQRY
FT                   GTRMETFAAVRAKASRHAANNPLALFRKQVTTEDVMNDTVLMPGVMTRLMACPPTCGGA
FT                   AAILVSEKFAKKHGLRTGVQIVAQSLTTDPPASFDPPSMLNYVGTHMTRSAANKVYEKA
FT                   GIGPEDIDVCELHDCFAHNEVICYESLGFCPEGGAEKFVSDGDNTYGGKVVVNPSGGLL
FT                   SKGHPLGATGLAQCYELTHQLRGTADQRQVQGAKLALQHNLGLGGACVVTLYGKH"
     MSEKVLVAGV GMIQFAKPGA SQSYTEMGAE ATRRALADAG IAYDLVQQAF AGYVYGDSTC        60
     GQTAIYEVGM TGIPIVNVNN NCSTGSTALY LARQAIATGD ADCVLALGFE QMQAGALKSH       120
     WDDRPVTRAR FVPIMHGLTA DLAHLPQALR TFGGAGREHM QRYGTRMETF AAVRAKASRH       180
     AANNPLALFR KQVTTEDVMN DTVLMPGVMT RLMACPPTCG GAAAILVSEK FAKKHGLRTG       240
     VQIVAQSLTT DPPASFDPPS MLNYVGTHMT RSAANKVYEK AGIGPEDIDV CELHDCFAHN       300
     EVICYESLGF CPEGGAEKFV SDGDNTYGGK VVVNPSGGLL SKGHPLGATG LAQCYELTHQ       360
     LRGTADQRQV QGAKLALQHN LGLGGACVVT LYGKH                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page