(data stored in ACNUC7421 zone)

EMBL: CP000271.PE295

CP000271.PE295       Location/Qualifiers
FT   CDS             341615..342364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2730"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2730"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33263"
FT                   /db_xref="GOA:Q13RM6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM6"
FT                   /protein_id="ABE33263.1"
FT                   /translation="MKVLVAVKRVVDFNVKIRVKSDGSGVELANVKMSINPFDEIAVEE
FT                   AVRLREKGVVSEVIAVSCGTSASQETLRTAMAIGADRGILVETDAELQPLAVAKLLKAL
FT                   VDREKPQLVILGKQAIDNDCNQTGQMLAALAGCAQATFASRVELSNDCATVTREIDGGL
FT                   ETLRLKLPAVVTSDLRLNEPRYATLPNIMKAKKKPLDVVTPEQLGVDVAPRLKALRTIE
FT                   PAGRSAGVKVPDVAALVAKLKNEAKVI"
     MKVLVAVKRV VDFNVKIRVK SDGSGVELAN VKMSINPFDE IAVEEAVRLR EKGVVSEVIA        60
     VSCGTSASQE TLRTAMAIGA DRGILVETDA ELQPLAVAKL LKALVDREKP QLVILGKQAI       120
     DNDCNQTGQM LAALAGCAQA TFASRVELSN DCATVTREID GGLETLRLKL PAVVTSDLRL       180
     NEPRYATLPN IMKAKKKPLD VVTPEQLGVD VAPRLKALRT IEPAGRSAGV KVPDVAALVA       240
     KLKNEAKVI                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page