(data stored in ACNUC7421 zone)

EMBL: CP000271.PE296

CP000271.PE296       Location/Qualifiers
FT   CDS             342375..343319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2729"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2729"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33264"
FT                   /db_xref="GOA:Q13RM5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM5"
FT                   /protein_id="ABE33264.1"
FT                   /translation="MTASNQVLVVAEHDQGSIRTATLNTVAAALQCGAEVHMLVAGYDA
FT                   TGAAQAAAAIKGVAFVLHADAPQLADGLAENIAAQVVALAANYGHILFPATSAGKNIAP
FT                   RVAALLDVAQVSDIVRVLSPDTFQRPIYAGNALVTVQSSDPVKVLTVRVTGFDAVAAEG
FT                   GAAQIEAIDTVADSGLSTFVERVVAKSDRPELGDAQIVVSGGRALGSNEKFTEVLTPLA
FT                   DKLGAALGASRAAVDAGFAPNDWQVGQTGKIVAPQLYVACGISGAIQHLAGMKDSKVIV
FT                   AINKDPEAPIFSIADYGLEADLFDAVPQLVNAI"
     MTASNQVLVV AEHDQGSIRT ATLNTVAAAL QCGAEVHMLV AGYDATGAAQ AAAAIKGVAF        60
     VLHADAPQLA DGLAENIAAQ VVALAANYGH ILFPATSAGK NIAPRVAALL DVAQVSDIVR       120
     VLSPDTFQRP IYAGNALVTV QSSDPVKVLT VRVTGFDAVA AEGGAAQIEA IDTVADSGLS       180
     TFVERVVAKS DRPELGDAQI VVSGGRALGS NEKFTEVLTP LADKLGAALG ASRAAVDAGF       240
     APNDWQVGQT GKIVAPQLYV ACGISGAIQH LAGMKDSKVI VAINKDPEAP IFSIADYGLE       300
     ADLFDAVPQL VNAI                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page