(data stored in ACNUC7421 zone)

EMBL: CP000271.PE297

CP000271.PE297       Location/Qualifiers
FT   CDS             complement(343725..344549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2728"
FT                   /product="Putative 3-oxoacyl-acyl carrier protein
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2728"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33265"
FT                   /db_xref="GOA:Q13RM4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM4"
FT                   /protein_id="ABE33265.1"
FT                   /translation="MGKLDGKVALVTGSGRGIGRAIAEKLASEGARLVINDLDADPAHE
FT                   TVEALKKMGAEAVACVGNVGAPDFADRFINTAMSTYKGIDIIVNNAGYTWDDVIQKMTD
FT                   EQWYAIIDCHMTAPFRILRAAYPHVKALHAADKEAGRDVYRKIVNISSTSALNGNAGQM
FT                   NYSSAKAGVIGMTRALSREWGRFNVNVNCVAFGLIHTRMTTADAHAGATVKIEGRDIRV
FT                   GLNPELLKTHAQRNPLGRGGTPEEAAGGVYLFCSPESNYITGQTIAVAGNLQ"
     MGKLDGKVAL VTGSGRGIGR AIAEKLASEG ARLVINDLDA DPAHETVEAL KKMGAEAVAC        60
     VGNVGAPDFA DRFINTAMST YKGIDIIVNN AGYTWDDVIQ KMTDEQWYAI IDCHMTAPFR       120
     ILRAAYPHVK ALHAADKEAG RDVYRKIVNI SSTSALNGNA GQMNYSSAKA GVIGMTRALS       180
     REWGRFNVNV NCVAFGLIHT RMTTADAHAG ATVKIEGRDI RVGLNPELLK THAQRNPLGR       240
     GGTPEEAAGG VYLFCSPESN YITGQTIAVA GNLQ                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page