(data stored in ACNUC7421 zone)

EMBL: CP000271.PE299

CP000271.PE299       Location/Qualifiers
FT   CDS             complement(345004..345444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2726"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2726"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33267"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM2"
FT                   /protein_id="ABE33267.1"
FT                   /translation="MIDKKHIGKVIPAFRTVAEAGRLRFFAKATGETNPVYFDESAARD
FT                   AGHPTLPLPPTFLFSLELEQPDKSWRDEIGIQVARILHGEQSFTYHKMAYAGDVLLFEC
FT                   RIADIYDKKGGALDFVVRETRVTNQKGEHVADMRSVLVHRNG"
     MIDKKHIGKV IPAFRTVAEA GRLRFFAKAT GETNPVYFDE SAARDAGHPT LPLPPTFLFS        60
     LELEQPDKSW RDEIGIQVAR ILHGEQSFTY HKMAYAGDVL LFECRIADIY DKKGGALDFV       120
     VRETRVTNQK GEHVADMRSV LVHRNG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page