(data stored in ACNUC7421 zone)

EMBL: CP000271.PE3

CP000271.PE3         Location/Qualifiers
FT   CDS             complement(2251..3633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3026"
FT                   /product="Putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32971"
FT                   /db_xref="GOA:Q13SG8"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG8"
FT                   /protein_id="ABE32971.1"
FT                   /translation="MLSPNPSSTRRMATKRAKKTDVVSPSSAELRKAVEAIAIQPKSGK
FT                   ITLLTRKLFNVLLAVAQQADESGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQV
FT                   EWSTGTSSQKPGRKWGISTLIADAEILEDPTTRRVWVEFSFAPKIKKKLLDPVQYARLS
FT                   LQFQSQLRSSAGLALYEICVRYLTNPSHLTMRETWEWWRPILSGTPDTEAGDEAKREYK
FT                   YFKRDYLRPAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDS
FT                   TLVDRMVKIGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTSLPPVRSAPALFKDALK
FT                   KGYAPPVEALPSSGGGKAAVAAPADDLKARLLGEYSAYRRKEARELYDEQGESEREIAR
FT                   QSFEEDELPGLGTHMRDDWRRRGLDSKIVETAFFDWLARKTWGEPTDGDLLAFTLSQSR
FT                   AA"
     MLSPNPSSTR RMATKRAKKT DVVSPSSAEL RKAVEAIAIQ PKSGKITLLT RKLFNVLLAV        60
     AQQADESGDT YRALLSDIVA NSAFDSNDTA LVKEHLRRMV SVQVEWSTGT SSQKPGRKWG       120
     ISTLIADAEI LEDPTTRRVW VEFSFAPKIK KKLLDPVQYA RLSLQFQSQL RSSAGLALYE       180
     ICVRYLTNPS HLTMRETWEW WRPILSGTPD TEAGDEAKRE YKYFKRDYLR PAIAEVNAVT       240
     NIFVELIEHR EGRRVAEIQF RVTERKQPML ALDEHPNVFD STLVDRMVKI GIPLKEAQTL       300
     YADSEENRIR AALQMTEQRM RSTSLPPVRS APALFKDALK KGYAPPVEAL PSSGGGKAAV       360
     AAPADDLKAR LLGEYSAYRR KEARELYDEQ GESEREIARQ SFEEDELPGL GTHMRDDWRR       420
     RGLDSKIVET AFFDWLARKT WGEPTDGDLL AFTLSQSRAA                             460
//

If you have problems or comments...

PBIL Back to PBIL home page