(data stored in ACNUC7421 zone)

EMBL: CP000271.PE300

CP000271.PE300       Location/Qualifiers
FT   CDS             complement(345472..346656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2725"
FT                   /product="Putative nonspecific lipid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2725"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33268"
FT                   /db_xref="GOA:Q13RM1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM1"
FT                   /protein_id="ABE33268.1"
FT                   /translation="MTRNVFVAGVGMIPFKKPGTSDPYDVMGAGAVREALIDAGIDYAD
FT                   VQQAYAGYVYGDSTCGQKALYHVGMTGIPIINVNNNCATGSSALFLARQAVQSGAVDCA
FT                   LAVGFEFMQPGALSSKWSDRAPALERALSVVNELVDRTDLPSAIRQFSGAGRAHMEKYG
FT                   TKLETFAKIRAKASQHAARNPLAVFRTVVTPEEVLASPMIWEGVLTRLMACPPTCGAAA
FT                   AIVVSEEFARKRGLRTDVLIAAQSLTTDLPSTYDSRDMIRVVGFDMTRAGAKLAYEQAG
FT                   VGPEDIDVIELHDCFAQNELLTYEGLGLCAEGEAEKLVNDGDNTYGGKWVVNPSGGLLS
FT                   KGHPLGATGLAQCYELTHQLRGTADQRQVEGAKVALAHNLGLGGACVTTVYKAA"
     MTRNVFVAGV GMIPFKKPGT SDPYDVMGAG AVREALIDAG IDYADVQQAY AGYVYGDSTC        60
     GQKALYHVGM TGIPIINVNN NCATGSSALF LARQAVQSGA VDCALAVGFE FMQPGALSSK       120
     WSDRAPALER ALSVVNELVD RTDLPSAIRQ FSGAGRAHME KYGTKLETFA KIRAKASQHA       180
     ARNPLAVFRT VVTPEEVLAS PMIWEGVLTR LMACPPTCGA AAAIVVSEEF ARKRGLRTDV       240
     LIAAQSLTTD LPSTYDSRDM IRVVGFDMTR AGAKLAYEQA GVGPEDIDVI ELHDCFAQNE       300
     LLTYEGLGLC AEGEAEKLVN DGDNTYGGKW VVNPSGGLLS KGHPLGATGL AQCYELTHQL       360
     RGTADQRQVE GAKVALAHNL GLGGACVTTV YKAA                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page